SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_045_00205.3|PACid:22027112 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_045_00205.3|PACid:22027112
Domain Number 1 Region: 50-111
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.53e-18
Family eIF5a N-terminal domain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 155-212
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000188
Family Cold shock DNA-binding domain-like 0.00061
Further Details:      
 
Domain Number 3 Region: 111-152
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000985
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_045_00205.3|PACid:22027112
Sequence length 212
Sequence
MAGIAAATINISVSSSSCFRSSSSVSFSPKLSFCPMRAFPKLSSRSRFQRIYAFSSNDIK
VGSNIEVDGAPWRVLEFLHVKPGKGAAFVRTKMRNYVTGNTVQKTFRAGSTSTYEEIRLN
ASDVGDKTKWLKEGTDCNVLFWNGKVIDFDLPINVKLSVVSVDPGLKGDTAQGGGSKPAT
VDTGAIVYVPLFVNTGDEIVVDTRTGQYMNRA
Download sequence
Identical sequences A0A2G5CMD0
Aquca_045_00205.3|PACid:22027112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]