SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_045_00208.1|PACid:22027238 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_045_00208.1|PACid:22027238
Domain Number 1 Region: 329-434
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-20
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_045_00208.1|PACid:22027238
Sequence length 935
Sequence
MAAVSSSSSSVYCMNAICGVTSSIRWTHGWRLRSGGFANLCERCGSAYEQSAFCDIFHLK
ESGWRECYTCSKRLHCGCIASKSLLVLTDNGGVQCINCIRSSELSNIQSDENPAGISMTT
TNNVGELQLTSLDYKMGSDDNGVKELMLSNMEGKERNNFLQSQKDDANGSLGQLKREQGL
SLVREVGSTTFSNFNETLFGATQFAKQNNHKDHVGGKDTYESLPQTCLTMTLGVSSGAAS
LAQPLVSSIVEGREQSKMSLQQGQRPRPRTSKMGIGIAPEASKDNHPQLRVARPPIEGRG
RNQLLPRYWPRITDQELQQISGDSNSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFPP
INQPEGLPLRIQDIKGKEWLFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRLD
PEGKLVMGFRKSASNCASVKDTQPAIPNAPNENFFSGVIENLPRMSGQPGLLQSFKGSTD
PHLNVVSERLHSADGDANLCKAEKQGGRPNGGLLLQPEKKKSRNIGSKSKRLLIDNEDAL
ELKLTWEEAHDLLRPPPRAKPNVVKIDEFDFEEYEEAPILGKKTIFTSLSSGGQDQWAQC
DSCSKWRRLPVDVFLPVNWTCSENAWDSKRSACSVPNELSPMELENLLRLNMDFKRRKVA
SQPVLDHEPSGLDALATAAVLGDSRLDVGTSLVATTTKHPRHRPGCTCIVCIQPPSGKGP
KHKPTCTCNVCMTVKRRFKTLMMRKKKRQSEKEAEVAQSKNQIWYPKDEEVESASQSAML
VLDSSENEGRQANMLDSSDQTKVLTEKTESSKAHLDLNFHPDREDDSLAMSARISMMGLL
QVANRPLETYLRQNGLSSLVTEQQASSGSHAPPQPTAEGEGRPADDGFCAAVPGEMEQEK
EQEHESEHEHEKESGGDLGDDGLDKSQCQSQNEPV
Download sequence
Identical sequences A0A2G5CME0
Aquca_045_00208.1|PACid:22027238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]