SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_045_00219.2|PACid:22027026 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_045_00219.2|PACid:22027026
Domain Number 1 Region: 4-204
Classification Level Classification E-value
Superfamily Chalcone isomerase 1.57e-48
Family Chalcone isomerase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_045_00219.2|PACid:22027026
Sequence length 205
Sequence
MGSEMVMVDDIPFPPQITTTKLLSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVEHLKQW
KGKTASELAEDDDFFDALISEKFLRIVVIKEIKGSQYGVQLESAVRDRLAADDKYEEEEE
EVLEKVVEFFQSRYLKKHSIITFSFSPKSDSLEISLSAEGKEESKIKVENANVVEMIQKW
YLGGTRGVSQTTISSLANNLGTLLS
Download sequence
Identical sequences A0A2G5CMP4
Aquca_045_00219.2|PACid:22027026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]