SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_047_00014.1|PACid:22064182 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_047_00014.1|PACid:22064182
Domain Number 1 Region: 3-44
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000537
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_047_00014.1|PACid:22064182
Sequence length 159
Sequence
MKIDGTGNLILHNAEDAFIWQSFDHPTDTWVSGQTLAIGQRVVASVSDLNRSSETKDPIL
VSASDYASYKFFYIWFDSDGHLRQYHFLDGMEKLVEDILSNELRDCGYPTVCGNYGICSD
DGQCSCPKGRNRDSSYFIKVQATSYLTCSAWKSSYREKH
Download sequence
Identical sequences A0A2G5CKM9
Aquca_047_00014.1|PACid:22064182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]