SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_047_00015.1|PACid:22064186 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_047_00015.1|PACid:22064186
Domain Number 1 Region: 482-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-76
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 83-160,187-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.58e-23
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_047_00015.1|PACid:22064186
Sequence length 814
Sequence
MTTTTCILNLSKSKLAECCMCNQKCFAKAVHGSPYTAIILNTARKPSIGFGFVSSSESSF
FYLVIFATEEKVTRLNVTTTRINLTVLWSANRDNAVKENATVEFDSHGDLILKEADGTFI
WSTNTSGKSIVGMRIVETGNLLLHDANNKTVWSSFDHPMADTWLPGQILVHGQRITARVS
PNNLTSGVFYLSVQHNGFYACIKADPPQVYNTIFHDGYRSLGASSTSGSQFNLNYGMTGS
LSSVNYSTGKDKEFQYMRLDSDGHLRVYQWYDASETLFTDVLTGKLGDCGYPTVCGEYGI
CSNGQCSCPISADGDPRYFRQINQIRPNLGCREETQLSCNSSALHYLELEYVSYFNNANV
MVNTDVENCKQACMKNCSCKAVEFRYYGNASNGNCSLPSHIFSLMANKEDILGYKSTTFL
KVQNPFPALDPKPSTRLIVGSLFGTLFVVFLIGLCVVVFRKIKHIEAEENDPYDEENVLL
EQTSEMPKRFSYEDLKSATRNFQKRIGGGGFGSVYDGILDNVTIAVKRLDDLGHGQGRKE
FLAEVQTIGSIHHVNLVKLVGFCTENSHKLLAYEYMCNGSLDKWIFHRDQESTLDWRTRR
KVILDVAKGLSYLHEDCRKKIIHLDIKPQNILLDSEFNAKVSDFGLARFIDRDECQVLTM
MTGTRGYLAPEWLLNRRISEKVDVYSFGVVVLETMCGRRNLDYSLSEEDEYLLHLVKRKA
EDDTLYDIVDKQSEDMQHHREEAVKMIRTAIWCLQGDCTRRPSMSMVVKVLEGVMDMENI
SDYSFLRLTPMVLSMEVDASASASLLASILSEPR
Download sequence
Identical sequences A0A2G5CKR8
Aquca_047_00015.1|PACid:22064186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]