SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_047_00050.4|PACid:22064148 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_047_00050.4|PACid:22064148
Domain Number 1 Region: 184-398
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.87e-56
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00015
Further Details:      
 
Domain Number 2 Region: 374-518
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.85e-35
Family Tyrosyl-DNA phosphodiesterase TDP1 0.000079
Further Details:      
 
Domain Number 3 Region: 27-111
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000884
Family FHA domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_047_00050.4|PACid:22064148
Sequence length 521
Sequence
MTTSQVKIGFLIPLNNNLEENNSNSKLPIYEGINVLGRNDISVADKRVSRKHVSLIGSVD
GSANVVVESSNPVVIRSRDQRIKLCFQEKGGILNGDIVEMIPGNHFFKYVNVDDEKDKTS
MQIYQRVSTQETILIQNEEVTLKRKRQIDEDEAYARALQVENGLAFQDDSEAIRHFSVPK
DRLPLTFQLLRVKGLPAWANTSSVSIGDVIRGNVLFAVLSNYMVDMDWLLSVCPNLAKIS
RVLVIHGEGDSTLYHLQKNKPANWILHKPPLPISYGTHHSKAMLLVYPRGLRVVIHTSNL
ISVDWNNKSQGLWMQDFPWKDQKDQSRSCGFENDLIEYLSALKLPEISINLPVIGNVKII
SSFFRRFDYSSAAVRLIASVPGYHNGPNLKKWGHMKLRTILQDCLFEKEFRNSPLVYQFS
SLGSLDEKWMAELAASMSSGLADDKTPLGLGKAQIIWPTVEDVRCSLEGYAAGSAIPSPQ
KNVEKDFLKKYWAKWKAIHSGRSHAMPHIKTFARYNGQNIA
Download sequence
Identical sequences A0A2G5CKR2
Aquca_047_00050.4|PACid:22064148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]