SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_049_00023.1|PACid:22044562 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_049_00023.1|PACid:22044562
Domain Number 1 Region: 428-492,519-764
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.66e-54
Family DNA repair protein MutS, domain III 0.0016
Further Details:      
 
Domain Number 2 Region: 766-1019
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-47
Family ABC transporter ATPase domain-like 0.00000417
Further Details:      
 
Domain Number 3 Region: 105-219
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 3.01e-30
Family DNA repair protein MutS, domain I 0.00066
Further Details:      
 
Weak hits

Sequence:  Aquca_049_00023.1|PACid:22044562
Domain Number - Region: 236-310,357-439
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.000144
Family DNA repair protein MutS, domain II 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_049_00023.1|PACid:22044562
Sequence length 1129
Sequence
MVKQKQQVISRFFAPKPKSPSSSSSFSTSNHPQNPIPLTPPSKITATASLSSSKRLRSSQ
LSSPSKKPKLSPHTQNPIPSLHEKFVQKLLEPSVTSTTDVNLSISSNPKYTPLEQQVLEL
KAKYPDVLLMIEVGYKYRFFGEDAEIAARVLGIYAHIDHNFMTASIPTFRLNVHVRRLVS
VGYKVGVVKQTETAAIKSHGSNRLGPFSRGLSALYTKATLEAAEEMAGGGEEGCGSSSNY
LICVVEKGVVVGDRECGVESGFDVRIGFVAVEISTGDVVFGEFNDNVMRMALEGVVLSLS
PAEVLLGEPLSKQTEKLLLSYAGPTSSVRVERASRNCFKDGGALAEVMVLCENMGGDSST
NVQERITENRAQGIHCLGVEGIMEMPGLAVQALALITHHLKQFGFQRILCLGASLRPFTS
NIEMTLSANALQQLEVLRNNSDGSETGSLLHALNRTLTIFGSRLLKHWVTHPLCDRNSIS
ARLDAVCEIAESMDKQNVCVIDSEDGCAAIAKPVISDVLSSALTTLGRSPDIQRGITRIF
HRTATASEFIAVIHAMLHAGKQLQQLQIRGEDDNGDLQEMTVHSALLRRLLLTASSPTVV
SHAAKLLSNLNKDAADQKDIQNLFIVSDGQFPEVATAQTTVQVANHKLDSLIDLYRKQLG
VRNLDFISVSGSTHLIELPLNVKVPSNWVKVNSTKKTIRYHPPEVMEALDELLLAKEELS
LACRSAWDSFLEGFSKYYAEFQASVQALAALDCLHSLAIISRSKNYVRPIFVEDSESVQI
HIHSGRHPVLDMILQDSFVPNDTNLQADGEYCQIVTGPNMGGKSCYIRQVALLAIMAQVG
SFVPASSAKLHVLNGIYTRMGASDSIQQGRSTFLDELSEASHILHKSTSHSLVIIDELGR
GTSTHDGVAIAYATLHDLLKKRCMILFVTHYPKIVDIKNTFPSSVGSYHVSYLTTENTQE
IVHPKLNQSKNMECGDITFLYKVVSGTSDKSFGLNVARLAQLPPMCIARAAVMAAKLEDL
VAYRVATQLGKQMLLEKESTCEGNNSDNLSKSPGHVLGEQPSNYSLMDAIGALGQLTATC
HEVFLNMKDAQMNSDNVRSFQSLKHASKVAVELMERLTVLGSSWRIGGT
Download sequence
Identical sequences A0A2G5CJK4
Aquca_049_00023.1|PACid:22044562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]