SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_049_00035.1|PACid:22044907 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_049_00035.1|PACid:22044907
Domain Number 1 Region: 110-195
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000726
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_049_00035.1|PACid:22044907
Sequence length 245
Sequence
MMNGRDGATSSAITVQLSEVRPAAAAQLFFFPQLKRLTNYKANNFNHNSLGLEEEKENNS
VQEEKQAANNLLHMRYTPVKDIKSFIKLGESLGRLPPIKELHGLIGQCTTRSFRKILTES
DVRDNQARLIIHAKFAKEAIKPLLRPNEKLSEGITAIMYDHRGKVYNMKYKQWTDKPHVI
FGDWLKFCKEHKLIALVHRIRLWAFRHSETDKLCFAITWELRALKIIEYRPEKKIENNNK
RKRKN
Download sequence
Identical sequences A0A2G5CKU9
Aquca_049_00035.1|PACid:22044907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]