SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_049_00164.2|PACid:22044911 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_049_00164.2|PACid:22044911
Domain Number 1 Region: 860-1105
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000301
Family Tropomyosin 0.0039
Further Details:      
 
Weak hits

Sequence:  Aquca_049_00164.2|PACid:22044911
Domain Number - Region: 241-354
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00115
Family Myosin rod fragments 0.0031
Further Details:      
 
Domain Number - Region: 601-711
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00366
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_049_00164.2|PACid:22044911
Sequence length 1136
Sequence
MASLSHSESRRLYSWWWDSHISPKNSKWLLENLSDMDAKVKTMIKLIELDADSFAKRAEM
YYKKRPELMKLVEDFYRAYRALAERYDHATGALRQAHRSIQEAFPNQDPFEPGDDSPSGS
SRPATPDGLHKDSLGLSSSHSHGLKRNGAYSTGSATSVKGLKELDELFGEGVPTLKIAEG
RMRRGLNYHEAEVNVSGHEMLNSSGDQANRKAQTEAESLKQALARAEAEKEASLFNYNQC
LLKISELETKVSLAEENARSLDERALRAETEVQSMKEAIAKLNVEKEAAALQYQHSLETI
STLQTELFQAQEEAIKLSNVVVMGVAKLNSTEEQYRQLERENRSLQTEVDNLVQMMSIQK
QELSEKHEELERLQIFIQEEYFRFMQGEATLQTKKTLHSEFQEEWRALPLEVQNDDQRPE
DMVLDYEGIEEEPCRVNMANEHNFSLAIAENNHQEEIFRSSDAEVKVDKEIEVLVDQRDE
LQQEIFSLKEEMDALKKRHLHIIDQIELVGLKPDCLALSVKSLNEENSKLKEICQLGNDE
KASLTEKVKVLEETCQSLQRLNSTVVNDKEFLISQLEIANRNIEKLSEKNTFLEGFLINV
NVEKVWLSEKSESLEEYCQSLDNERHELFITNDNIVSQFTDVQQKLDDLGRKHTDIKKDH
SDLMKEREAKTHQVEELQVSLNHEKKEHASFMHSRETEIARLEGNIHILQEEGKRRMKEI
EEEQDNSVKAQLEILILQRCIRDMEERILLLFTEYQKHLETSKLSETLLTNLERQNFEQK
VKVNSLLDQVEKLRFGISQMTSSVEFKPDSECCVEIEDDQILLQLARRKIEDMERALWSN
QDEKHQLLFEKSVLLILLGQLKLEAATIESKRSALDRDLNLETKARLLLESERNTLLSKN
DHLNHQIGIAKDMLSQKEMELSETEQKLKDLESENMELYRKLDDMNKECDEARLREGILE
KQILSISENYAQQNKEIECLHEETENLELEMNRLHEKVKEQRVKGDDLSFSLQQSRNEIK
LWEYEAETLYDNCQVATIHEALFKEKVYELAGACEALANERDSKSVDVEQLKERLHLLEL
ENGGVKSELAAYLPVLVSLRDNVTSLEEQIFPQTESFVVDNQKAKVWFFPYKVVRS
Download sequence
Identical sequences A0A2G5CK37
Aquca_049_00164.2|PACid:22044911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]