SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_049_00178.7|PACid:22044694 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_049_00178.7|PACid:22044694
Domain Number 1 Region: 465-535
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.000000000826
Family Germin/Seed storage 7S protein 0.002
Further Details:      
 
Weak hits

Sequence:  Aquca_049_00178.7|PACid:22044694
Domain Number - Region: 145-173
Classification Level Classification E-value
Superfamily Tim10-like 0.0152
Family Tim10/DDP 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_049_00178.7|PACid:22044694
Sequence length 545
Sequence
MVSNSKLSFCFLSIFLLSASLSLGLDPGSQYQQCQERCRTQQPGKQQEQCLEQCEEYQQC
QQQCPQRGQESQQCQQRCEEQYEQQEDPEREYQKCQQVCSHQKPGQQQQQCQEFCEEYRR
YSRPQQDGVIRLIAEQGQDPQREYQQCQQECRQQPGQAQQQCLLQCVERYSKEQQDGGIR
LITEEGRDPQREYQQCQQDCRIKPGQQQQQCQEFCEEYRQCQQECRQQPGQAQQQCLLQC
VERYSREQQDGVIRLITEEGRDPQREYQQCQQDCRKKPGQQQQQCQEFCEEYRQCQQECR
QQPGQAQQQCLIQCVERYSTEQQDDAHLDNKNPEKKYQKCQKKCGKKQGQEQQQCQQQCE
EIYHKKQETGGDSGREQETAGGSGTEQETAGGSDMLNVRETQDPQSEFQQCQRQCRQKQQ
GQEQQQRCMEQCKKELEERQREQGSGEGQKGYEGEAGQHGGEEAENPYLFRQERFSSHVR
SEEGNVRVLERFNMRSNLLNGIENYRVAILETNPNSVEIPNHWDADTVCFVIRGKFSSSS
VTQIP
Download sequence
Identical sequences A0A2G5CKC6
Aquca_049_00178.7|PACid:22044694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]