SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_049_00181.2|PACid:22044790 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_049_00181.2|PACid:22044790
Domain Number 1 Region: 4-52
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.0000000000263
Family Cyclophilin (peptidylprolyl isomerase) 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_049_00181.2|PACid:22044790
Sequence length 79
Sequence
MVKKKNPLVFLDVSIDGSRPEKIAMELFSDVVPKTAENFRALCTGTQVEAFFTIPFYVKK
ALELPLESHYILKDQFFIV
Download sequence
Identical sequences A0A2G5CKA8
Aquca_049_00181.2|PACid:22044790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]