SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_049_00221.2|PACid:22044899 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_049_00221.2|PACid:22044899
Domain Number - Region: 71-243
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00174
Family WD40-repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_049_00221.2|PACid:22044899
Sequence length 278
Sequence
MATNLSYFFINFSLFILFLHVHFSYATAAAVRPIEDENRRCWSCPSPSGRCCLSADIGFE
EADLNRQCWSCPSPSGRCCLSAEADPNRRCWSCPSPSGRCCLSVDISVTEAADPNRRCWS
CPSPSGRCCLSAEADPNRQCWSCPSPSGRCCLSVDTSVTNVDPNRRCWSCPSPSGRCCLS
AEADPNRQCWSCPSPSGRCCLNADISVIEAADPNRRCWSCPSPSGRCCLSAEADPNRQCW
SCPSPSGRCCLNVDVNVMEADKSATIGQVHTMLGVSAA
Download sequence
Identical sequences A0A2G5CKE1
Aquca_049_00221.2|PACid:22044899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]