SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_050_00030.1|PACid:22033233 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_050_00030.1|PACid:22033233
Domain Number - Region: 197-332
Classification Level Classification E-value
Superfamily Tropomyosin 0.000111
Family Tropomyosin 0.0026
Further Details:      
 
Domain Number - Region: 88-195
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00102
Family Myosin rod fragments 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_050_00030.1|PACid:22033233
Sequence length 346
Sequence
MLTPRRAGWPSNWSSTPKTTNSRNNNNNNKFVDNRSISKRKAVALFETTPPPPPLSSLGG
RGGEVDIDGGEEDQEVWKKFREEGLLDEATLLKRDREALAEKVSRVENELLEYQYNMGLL
LIEKRDWTSKLDELRQALAEANELLKRETTAGRNAISEAEEREDNLRKALGVEKQCVVDL
EKALREMRTESAEIKYTADSKMAEANALIAKTEEKSLEVESKLHAADAKLAEASRKSSDL
ERKLKEIEARESSLRSERQSFNAERGMHESALSKQIEELADWERTLQEREERLSEGRRII
NQREEKANESDLLLKQKEKDLEEVQKQIENKNEVHTCFPSHHLLYH
Download sequence
Identical sequences A0A2G5CJ80
Aquca_050_00030.1|PACid:22033233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]