SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_052_00051.1|PACid:22061972 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_052_00051.1|PACid:22061972
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000364
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_052_00051.1|PACid:22061972
Sequence length 99
Sequence
MAKVVYEGWMVRYGRRKIGRSYIHMRYFVLESRLLAYYKKKPQDNVVPIKTLLIDGNCRV
EDRGLKTHHGHMVYVLSVYNKKEKYHRITVRDLFPILKF
Download sequence
Identical sequences A0A2G5CIQ8
Aquca_052_00051.1|PACid:22061972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]