SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_053_00089.1|PACid:22026531 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_053_00089.1|PACid:22026531
Domain Number 1 Region: 89-197
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.12e-27
Family Canonical RBD 0.0029
Further Details:      
 
Weak hits

Sequence:  Aquca_053_00089.1|PACid:22026531
Domain Number - Region: 34-96
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0942
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_053_00089.1|PACid:22026531
Sequence length 245
Sequence
MEHQEQDNEHEVYGGEIPDEGEMDADVEMSSRAEDGDEEDPNSKENLEEMKKRLKEIEEE
AGALREMQAKVEKEMGAVQEDPSGVAATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQS
CGTVNRVTILTDKFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNVPGLK
QFRGRRPNPYLGFRGRRPFMPAPFFSPYGYGQMLCSESDCFHSPLVLNVHWDSSWMDLKV
ILVAS
Download sequence
Identical sequences A0A2G5CJL1
Aquca_053_00089.1|PACid:22026531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]