SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_053_00089.2|PACid:22026532 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_053_00089.2|PACid:22026532
Domain Number 1 Region: 89-197
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.58e-27
Family Canonical RBD 0.0029
Further Details:      
 
Weak hits

Sequence:  Aquca_053_00089.2|PACid:22026532
Domain Number - Region: 34-96
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0811
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_053_00089.2|PACid:22026532
Sequence length 226
Sequence
MEHQEQDNEHEVYGGEIPDEGEMDADVEMSSRAEDGDEEDPNSKENLEEMKKRLKEIEEE
AGALREMQAKVEKEMGAVQEDPSGVAATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQS
CGTVNRVTILTDKFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNVPGLK
QFRGRRPNPYLGFRGRRPFMPAPFFSPYGYGKAPRFRRPMRYRPYY
Download sequence
Identical sequences A0A2G5CIB4
Aquca_053_00089.2|PACid:22026532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]