SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_053_00139.2|PACid:22026366 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_053_00139.2|PACid:22026366
Domain Number 1 Region: 406-503
Classification Level Classification E-value
Superfamily PH domain-like 0.000000168
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_053_00139.2|PACid:22026366
Sequence length 1474
Sequence
MLAHKFVEQSTKSDVYLKKQKTNKSWWSLGWTADSVEDESEPWRFGEEDWERLNKIIGYK
ESDGAPVLESQDKENTLQTSLEVHMKHNASKLVAHQQCLAELSCEGLDCFVMLYSEAKVF
DLKLGSYRLSSPHGLLAESATIDDSLVGVFTLKPFGTKFDWSLVAKASPCYMTYIKNSID
QITKFFESGAVSQSIALETAAAVQMTIDEVKRTAQQQVTRALKDHARFLLDLDIAAPKIT
IPTNFCPDGSHGTKLLLDLGNLMLHTQDENDLTSPEENDMYLQFNLGLSDVSAFLVDGDY
HWSQSALPMSGNAFPKKHSILPVIDKCGIVLNLQQIRAENLSYPSTRIAARLPSLGFHFS
PASYHRLMQVVKIFQNEDNENSDYVRPWDQADIEGWSSILVWKGVGNREAAWRRRYICLV
GPFLYVLESPESKTYKHFLSLRGKQVYQVPTEFTGNVEHVLALSDAGQPNSKVVEDVSAL
ILRFDSDDSRRTWQGRFQGAIYRASVSATVTAISDTSSDSGDTEAELLDESNVMNMSTME
KFFITGVLDELKVSFSYSCQSNQGFKTMLLSEESPLFEFRAKGGQVELSTRGNDMLIGAV
LKSLEIEDLVFCEGNTRPRYLAKSLIKNTDILTVDAMPTLTDVGNRTDSGSDIAQNDGED
DFFEASENLGEFVDCQAQSPGNVPKYLSAEHSFPSGKMSIKPPSFSRIAGLLPDSDLPRG
NEDLKLIDTLDSFVKAQIVIYDQMSPLYNNIDKQVTVTLATLSFFCHRPTILAVLEFVNA
INIEDEKNNLNDKYSAVKEQDDSIDEQNFSTIQEPVVKGLLGKGKSRVIFYLSLNMARAQ
IILMNENGTQLATLSQNHLLTDIKVFPSSFSIKAALGNLKISDDSLPGSHSYFWVCDMRN
SGGTSFVEEIASYFMGLVPKDSKSVVKLKDQVTNSEKWFTTSEIEGSPALKLDLSLRKPI
IVMPRRTDSHDFLELDVVHITVQNTFQWLCGDRNEMGAVHLEIMTIQVEDINLTVGTRTG
HGESIIKDVKGLSVVLRRSLRDLLHQIPTTAVAVKIDVLKAALSNKEYQIITECALSNIS
ETPNNVPPLTPIHVAHSDNLDLSLPVPSDAELESLDKESWITMTVLVAVSLVELSLHSGV
TRDAALATVQASGAWLLYKSNSLGDGFLSATLKGFAVIDDREGTQQEHRLAIGKSERLGY
SPLLFVPNAEKDRTQSDNNVVKRSDVKPVPTMLILDAKLNQSLTSVSICIQRPQLLVALD
FLLAVVEFFVPTVRNIVTNEEDQDPLHVSAIIPDQSTYSQPSNEFSLSPQRPLIIDNERF
DHYIYDGKGGVLHLQDRDNLDLSIPSIEPIIFVGNGKSLQFKNVHVKNGKYLDSAIYLGA
NSRYSASETDHVYLENENGGIDQNPNEVGDNSIPAQAVVADQSTQFIIEFQYVFVVCFVI
LSTFSKAVNSVDDFPCEESKKQVQFNEGVSLIEL
Download sequence
Identical sequences A0A2G5CIH3
Aquca_053_00139.2|PACid:22026366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]