SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_054_00035.1|PACid:22037080 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_054_00035.1|PACid:22037080
Domain Number 1 Region: 367-405,476-699
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.16e-52
Family WD40-repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 180-213,303-409
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 0.00000034
Family Prolyl oligopeptidase, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_054_00035.1|PACid:22037080
Sequence length 846
Sequence
DNPPQIPIPKFPISSVSNFDVWINGPLSIQARRKRLLQEMGLSNDPLLSRNNHDFDIGRS
ASDDHLCRRQPHIDIGIDSDCFIVRSKSDGSVTTTTTSDHCNHSSISSSIHSVESVSKNV
SFLDDNSNVYVSSNGSSTAATNNSNKPPTGRNLRRMERIRPFWTNLNPNCNKDLRDSSLV
RVDGNGEECAVNSDCIGGGNHSDMFCKIKNLDNGKEFVVNEVREDGMWNKVREIDTGHQL
TAEEFESCVGHSPIVQELMRRQNVENLEAKKDEFEVNENGGTGGGDNGSKSKKKVSWLKT
IKNVASAVTGHWEKRNSVEWDSSSDKVGRRSSSGTEDGQNTSFHCPEKVRVRQYGKSWKE
LTALYKNQKIQAHNGSIWSIKFSLDGQYLASAGEDCVIHVWQVIESDKRGEFLVEKSDDG
SLNPFFLVNGSPELTLVPSLADTHLEKKRRSKVSISRKSVNLGHVVMPDSVFALSETPIC
SFRGHLDDVLDLSWSKSQYLLSSSMDKTVRLWHMDSHACLKIFSHSDYVTCIQFNPIDDR
YFISGSLDAKVRIWSIPDRQVVDWNDLHEMVTAASYTPDGQGALVGSYKGSCRLFNTSEN
KLQQKSQIDLQNKRKKSHLKKITGFQFAPGRFSEVLITSADSRIRVVESTDLVHKFKGFR
NANSQMSASLTANGKYVVCASEDSCVYVWKHESNSRPGRNKGVTVTRSHEHFHCQDVSVA
IPWPVLDVTTGTGEQNRLMDDMSGVEHFSPQAESDQHRTSPLLYGSTNGTQHDTVSNVNN
SYFFDRFSVTWPEEKLPVAGRNQIARSFDLSNGMTQDRAALGMVIVTASLKGEIRVFQNF
GLPVHV
Download sequence
Identical sequences A0A2G5CH99
Aquca_054_00035.1|PACid:22037080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]