SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_054_00045.1|PACid:22037174 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_054_00045.1|PACid:22037174
Domain Number 1 Region: 90-425
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 1.74e-104
Family Catechol oxidase 0.00000000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_054_00045.1|PACid:22037174
Sequence length 587
Sequence
MGSLSPLNYNTITTTSSPLYPFPLKKTKISAFGKPSINRVTRRVLITCNARNEESMGKLD
RRNVLLGLGGLCGLSGLSATDNRLAMAAPIMPPDLSKCGPADFPPGSQPTNCCPPTDLKI
VDFKLPSRSTPMRVRPAAHLVDDEYIAKYSRAIALMKALPDDDPRSFKQQANIHCAYCDG
AYDQVGFPNLEVQVHNSWLFFPFHRYYIYFHEKILGSLIGDPTFALPYWNWDAPGGMRMP
TLYADSNSALYDPLRDAKHQPPVMVDLDYDLIDPQISEQEQININLSIMYRSVVSNGKTA
QLFLGSPYRAGDEPDPGPGSFENVPHGTVHLWAGDRTQPNNENMGNFYSAGRDPIFFCHH
SNIDRMWTIWKGLGGKRKDFTDPDWLNAGFLFYDENKQLVRVKVRDCLDQKNLRYTYQEV
DIPWLKTRPTAGKAKAPVAPKKASPRSLNSREESSNIFPRALDSVVKVKVARPKKSRSKK
EKEDEEEILVIEGIEYDRDSMVKIDIYINDEDETTTNPAQSEFAGSFVNVPHKHGMKMKK
LNTCLRLGIADLLEEIDAEDDDEIVVTLVPRQGKDVTIQGIKIVVAS
Download sequence
Identical sequences A0A2G5CHC6
Aquca_054_00045.1|PACid:22037174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]