SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_054_00047.1|PACid:22037200 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_054_00047.1|PACid:22037200
Domain Number 1 Region: 87-416
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 2.29e-74
Family Catechol oxidase 0.000000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_054_00047.1|PACid:22037200
Sequence length 586
Sequence
MSLSLLATSTVPSSSLLNVNPLRSNTKNRSTVRVGKKVAYTSCEQKQSNEGDSHTIDRRN
VLLGLGGLYGASATIGSQGKIAMGAPVAPPDLSKCQLATDAANGEQVYCCPPYSSADIKP
FVPPNDGILRKRKPAHKLNRKEIEDFKRGIQLMKELPETDPWSYYQQATIHCTYCNGAFD
QVGFEDVLLQIHGSWLFTPWHRYYIYFWEKILGKLLKDPTFAIPYWSWDTPEGMYMPGMY
LDRNSPLYDDNRNHNHFTALMDYDFTWGAPNPTPEQEEEVKIRNLKKIHNMFTETIGAPS
LFLGGPLSAGQVPQDIAGALENQHGLPHQWTGPEAIPRHDMGNFYTAARDTMFFGHHANV
DRLWDIYSDLRGNKVEFDNPDWLDASFIFYDENRQVVNCKVRDCLITENLGYTYTTERHA
WKDIKRTYKKLQRGKKRSAGEGLSLIPVSEFGSAPRALNSTIRVLVPRPKVSRSTDEKEE
FSEVVVVEGIKFGHGESTKFDVYIAKPIEGLVGPDLGELAGSFVRVTHTHHKKDKVETTS
KIELGVTNLLDDIEAEASDSLVVSLVPQHGDVTIGGVRIDLFASDI
Download sequence
Identical sequences A0A2G5CHD7
Aquca_054_00047.1|PACid:22037200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]