SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_054_00047.3|PACid:22037202 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_054_00047.3|PACid:22037202
Domain Number 1 Region: 13-330
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 1.11e-73
Family Catechol oxidase 0.000000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_054_00047.3|PACid:22037202
Sequence length 500
Sequence
MYFLNLFIISNYLFSFRTKKVYCCPPYSSADIKPFVPPNDGILRKRKPAHKLNRKEIEDF
KRGIQLMKELPETDPWSYYQQATIHCTYCNGAFDQVGFEDVLLQIHGSWLFTPWHRYYIY
FWEKILGKLLKDPTFAIPYWSWDTPEGMYMPGMYLDRNSPLYDDNRNHNHFTALMDYDFT
WGAPNPTPEQEEEVKIRNLKKIHNMFTETIGAPSLFLGGPLSAGQVPQDIAGALENQHGL
PHQWTGPEAIPRHDMGNFYTAARDTMFFGHHANVDRLWDIYSDLRGNKVEFDNPDWLDAS
FIFYDENRQVVNCKVRDCLITENLGYTYTTERHAWKDIKRTYKKLQRGKKRSAGEGLSLI
PVSEFGSAPRALNSTIRVLVPRPKVSRSTDEKEEFSEVVVVEGIKFGHGESTKFDVYIAK
PIEGLVGPDLGELAGSFVRVTHTHHKKDKVETTSKIELGVTNLLDDIEAEASDSLVVSLV
PQHGDVTIGGVRIDLFASDI
Download sequence
Identical sequences A0A2G5CHD9
Aquca_054_00047.3|PACid:22037202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]