SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_054_00047.4|PACid:22037203 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_054_00047.4|PACid:22037203
Domain Number 1 Region: 87-405
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 1.96e-69
Family Catechol oxidase 0.000000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_054_00047.4|PACid:22037203
Sequence length 431
Sequence
MSLSLLATSTVPSSSLLNVNPLRSNTKNRSTVRVGKKVAYTSCEQKQSNEGDSHTIDRRN
VLLGLGGLYGASATIGSQGKIAMGAPVAPPDLSKCQLATDAANGEQVYCCPPYSSADIKP
FVPPNDGILRKRKPAHKLNRKEIEDFKRGIQLMKELPETDPWSYYQQATIHCTYCNGAFD
QVGFEDVLLQIHGSWLFTPWHRYYIYFWEKILGKLLKDPTFAIPYWSWDTPEGMYMPGMY
LDRNSPLYDDNRNHNHFTALMDYDFTWGAPNPTPEQEEEVKIRNLKKIHNMFTETIGAPS
LFLGGPLSAGQVPQDIAGALENQHGLPHQWTGPEAIPRHDMGNFYTAARDTMFFGHHANV
DRLWDIYSDLRGNKVEFDNPDWLDASFIFYDENRQVVNCKVRNLFLVIYLRIFVLITCNT
YSGIHSFSICL
Download sequence
Identical sequences A0A2G5CHB1
Aquca_054_00047.4|PACid:22037203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]