SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_054_00067.1|PACid:22037053 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_054_00067.1|PACid:22037053
Domain Number 1 Region: 15-314
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.11e-93
Family WD40-repeat 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_054_00067.1|PACid:22037053
Sequence length 318
Sequence
MSSRGGSQPPPSPPYRPYRLLKTLTTHTSAVSCVRYSNDGTLLASASLDKTLIVYSTQTF
TPLSHLKGHSAGVSDLAWSSDSHYICSASDDRTLRIWDARSGESFKTLRGHSGYVFCVNF
NPQSNLIVSGSFDESIRVWDVKTGKSLHVIQGHNMPVTSVHFIRDGSIIVSSSHDGSCKI
WDAATGACLKTLIDEKNGPAVSFAKFSPNGKFILVATLDDTLKLWNYSTGKFLKIYTGHV
NKVYCITSTFSVTNGKYIVSGSEDHCVYIWDLQLKNMVQKLEGHTDTVISVSCHPTENKI
ASAGLNNDRTVRIWAQDP
Download sequence
Identical sequences A0A2G5CHH5
Aquca_054_00067.1|PACid:22037053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]