SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_054_00074.1|PACid:22037015 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_054_00074.1|PACid:22037015
Domain Number 1 Region: 141-338
Classification Level Classification E-value
Superfamily Chalcone isomerase 1.96e-28
Family Chalcone isomerase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_054_00074.1|PACid:22037015
Sequence length 340
Sequence
MKPTRICISSNTLNLTSSTHNNNIFLPFLSILDLESNQTLKKMVSLRFPFLFSQPSKLPQ
NPHNGSSSSSSRSFSTIAMAGSIAAIAGVGIGIGVSISHKNTNKKDPFLQNALDFFLSHH
NSSLPLWGSLSLADTSSENVVETKTGTSFPTILNDTQRLLGIGLRKKSVFGLKNIDVYAF
GVYADDSDVKKVLGEKYGKFSVSELKENKEFHEDIMDKDISMTVRLQIVYGRLSIRSVRS
SFEESIGSRLQKLGGTDSKEVLQRFTSFLKDEIKVPSGSVIDLSREHGHILRTTINGKDV
GNIQSKLLCRAVLDLYIGEDPFDAQAKEDTELNLASLVQK
Download sequence
Identical sequences A0A2G5CHG0
Aquca_054_00074.1|PACid:22037015 Aquca_054_00074.2|PACid:22037014 Aquca_054_00074.3|PACid:22037013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]