SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_054_00111.3|PACid:22037004 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_054_00111.3|PACid:22037004
Domain Number 1 Region: 393-589
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.85e-37
Family G proteins 0.0051
Further Details:      
 
Weak hits

Sequence:  Aquca_054_00111.3|PACid:22037004
Domain Number - Region: 148-223
Classification Level Classification E-value
Superfamily Thiamin phosphate synthase 0.00129
Family Thiamin phosphate synthase 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_054_00111.3|PACid:22037004
Sequence length 837
Sequence
MNRTQVKYEPQIRFRSSSSSSSSSSSSSSIHSFFFSLQNPNCSTYHIQMVSLLPYSTPIQ
LSKLPANFKIQTSFFHRHNRTHLNTSTRRFLVNSIETNSFESNSLNQSQDKQKQQPRRTL
FPGGFKRPEIKVPTLILQLNSDDVLNDKDRVLDYVDVAVSKWVGIVVIDGGRLYEAACLL
KSVIRDRAYLLIAERVDIASAVDASGVLLSDQGLPALVARNMMMESKSNSVVLPLVARTV
HTVNTALSASNSEGADFLIYGVDSEKFAEVLLNSVIQSIKVPVFTTIALEREDVSLTQAL
KLLESGASGLVMSLGNMKLFSNESLSRLFSSVNVIKEGTQVGSQKIKQFETDKELRVKNG
VAGFIKLDDREKQFIENEKEILLEALSVIRKAAPLMDEVSLLTDAVAQLDDPFLLVIVGE
FNSGKSSVINALLGRRYLKEGVVPTTNEITLLCYSEKDANAQERCERHPDGQFICYLPAP
ILRNMNLVDTPGTNVILQRQQRLTEEFVPRADLILFVLSADRPLTESEVAFLRYIQQWKK
KVLFVLNKADLYQSASELEEAIAFVKANVQKLLKTEQVTLYPVSARSALETKLNAYSVAG
INHQDLLLNDSIWRSSGFYELEKFLFSFLDGSTDTGMERMKLKLGTPVGIADRLISSCES
FVRNDFESANQDLISIREILNEVRAYMMKMENESTSWRRQTLSLINNAKVRAVRLVESTL
QLSNLDLVASYVFKGNKKGMMPITSNVQNDIVGPALSDAQKLLGEYLIWLQSNNAREGRL
YKEKFEKRWPYNQHDLIHLRTYELQEKGEERSIKVLENFSAAAAATLFEQEIREVVS
Download sequence
Identical sequences A0A2G5CHR3
Aquca_054_00111.3|PACid:22037004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]