SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_055_00004.1|PACid:22054360 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_055_00004.1|PACid:22054360
Domain Number 1 Region: 79-222
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.00052
Further Details:      
 
Domain Number 2 Region: 5-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.53e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_055_00004.1|PACid:22054360
Sequence length 231
Sequence
MEKKEVKLLGLWSSPFVARVIWALKLKGIEYEYIEEKDLMQNKSPLLLESNPVSKMVPVL
IHGGKPICESLNILEYIDEVWSDNRLLPEDPYEKAIVRFWAKFAEEKLAESARTILTSEG
EELENEVKQFEEALDILEKEIKDNIKKFFGGETIGYLDLVLGWSGLWLEIIEELSCGKKI
SSDTHRYPTFNRWIEDVNDVNIIKENLPSKDQLSTYLLYIRNLALAYKAKN
Download sequence
Identical sequences A0A2G5CGR4
Aquca_055_00004.1|PACid:22054360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]