SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_055_00058.1|PACid:22054291 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_055_00058.1|PACid:22054291
Domain Number 1 Region: 90-171,199-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-27
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  Aquca_055_00058.1|PACid:22054291
Domain Number - Region: 400-431
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00432
Family Pan module (APPLE domain) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_055_00058.1|PACid:22054291
Sequence length 452
Sequence
MSLAISIPLPFFIILLFSIVVQAVVPANKTFVIVNEGGYGDYPDEYDSNYRLVNNDEYFF
QENGFALCFYNTTPSAYTLALRMGMRREGSSSNIMRWVWAANRDNPVGENATLTFGRNGN
LVLAEANGRVAWQTGTANKGVVGISLLRNGNLVLQDNRGRFVWQSFNYPTDTLLVGQGIR
SGGTTELISRVSNVDGSKGPYSVVLEKQRVVMYLKSKNSPKPILYHVLVDQGGFEIIDSV
VFNSVPEPEDAYVYNLNLDFYVHNSTTPFSPRLARPRYNSILSFLRVESDGNLRIHTYDD
RIIRGSWEVTYRLFNRNEEGSRSVSECRLPSRCGSYGVCLNNNCVGCPSPKGILLAWSET
CASPTLPPCKNGSPPIKASYYKVVGVEHFTSEVTEGEGPVKVSECRGKCNQDCGCLGFFY
REESSKCLIAYELGTLTKVANQSHVAYIKMSK
Download sequence
Identical sequences A0A2G5CGV5
Aquca_055_00058.1|PACid:22054291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]