SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_055_00059.1|PACid:22054292 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_055_00059.1|PACid:22054292
Domain Number 1 Region: 9-89,117-133
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-27
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  Aquca_055_00059.1|PACid:22054292
Domain Number - Region: 318-349
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00326
Family Pan module (APPLE domain) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_055_00059.1|PACid:22054292
Sequence length 370
Sequence
MGSRPEDSTSNIMRWVWAANRGNPVGENATLTFGRNGNLVLAEANGRVAWQTGTGNKGVV
GISLLRNGNLVLQDNRGRFVWQSFNYPTDTLLVGQGIRSGGTTELISRVSNVDGSKGPYS
VVLEKQRVVMYLKSKNSPKPILYHVLVDQGGFEIIDSVVFNSVPETEDAYVYNLNLDFYV
DNSTTPFSPRLARPRYNSILSFLRVESDGNLRIHTYDDRIIRGSWEVTYRLFNRNEEGSR
SVSECRLPSRCGSYGVCLNNNCVGCPSPKGILLAWSETCASPTLPPCKNGSPPIKASYYK
VVGVEHFTSEVTEGEGPVKVSECRGKCNQDCGCLGFFYREESSKCLIAYELGTLTKVANQ
SHVAYIKMSK
Download sequence
Identical sequences A0A2G5CH03
Aquca_055_00059.1|PACid:22054292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]