SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_056_00002.1|PACid:22060630 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_056_00002.1|PACid:22060630
Domain Number 1 Region: 322-535
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.3e-73
Family Pseudouridine synthase II TruB 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_056_00002.1|PACid:22060630
Sequence length 540
Sequence
MAKSITQVSLLFLYSKTMISSTRIPLSFSSKFKFLNKTLSNSSSSSFSTTATRYPLQYDL
IISRPPHSQHTSLPRRKSLKPQKALLSNNNDSNDLNESEEVENSEMGIDGWVDKKLSEKD
SSTPMLENVEIMDKSKRKYYNKRRKRMYGSDSDDGKSEEDKFIELKQEVVDFPRLHQREE
ELYFYDAFAYPWEKDKHYKMVYQLEKKYFPDQCFDKAFVQPGEEAKGKVKKSNNLGKSGE
KKDKVVDEVDNNKGMVFFEEKEEGKNDKRDTGSKDITERKVEEFFKCLKKAPSNAGEVAS
DEPYLLTRSTELPARWDSPRGTVVLVNKPKGWTSFTVCGKLRRLVKVQKVGHAGTLDPMA
TGLLIVCVGKATKVVDRFQGMIKGYSGIFRLGEATSTWDADSPVIQRDPWEHIKDEDIKK
VAASFCGEIWQVPPMFSAIKVGGEKMYEKARRGETIELSPRKISIFQFDIERSLNDRQNL
VFRVTCSKGTYIRSLCADLGKALGSCAHLTALRRDSIGQYSADDAWEFQELEEAITKSYF
Download sequence
Identical sequences A0A2G5CGB8
Aquca_056_00002.1|PACid:22060630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]