SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_056_00095.1|PACid:22060671 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_056_00095.1|PACid:22060671
Domain Number 1 Region: 160-285
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 2.09e-36
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 57-159
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.15e-31
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_056_00095.1|PACid:22060671
Sequence length 292
Sequence
MATNLVRRTILSSSLLSRVSTTTTTTTPSTWKLLSIRAFASEAEAQQIEPKAKDSSKMKT
FSIYRWNPDNPSKPQLEDFQIDLKDCGPMVLDALLKIKNEIDPTLTFRRSCREGICGSCA
MNIDGCNGLACLTKIESTTPTSTVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPA
ETPAKEILQSKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHAHRWISDSR
DEYTTERLDAINDEFKLYRCHTILNCARACPKGLNPGKQISAIKHKNEFGAR
Download sequence
Identical sequences A0A2G5CGG8
Aquca_056_00095.1|PACid:22060671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]