SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_057_00009.2|PACid:22057403 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_057_00009.2|PACid:22057403
Domain Number - Region: 142-236
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0012
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_057_00009.2|PACid:22057403
Sequence length 314
Sequence
MAGRNHRGLKGPPIHEQPPFGRLQTMPHHHPAILEEMREVAQFGGRRGGGGGDHGHQMLP
PHHPVFIEERLAAQHQEIQGLLGDNQRLAATHVALKQELEAATHELQRMAHIADSLHAEK
DIQLREVYEKSMKMEAEIHGIEGMKAEVIQVRSDVQKLSVVRQELTTQVQGLSQDLTRVN
ADLQKVPALRADIETMKQELERARVAIDYERKGHAERYDKGQAMENNLILIAREVEKLRA
EVANGEMRVRAAASVGNPGYSGNYTNPEPGYGGNPYSSGYGMNPVQNAAEGAAQYGPGPA
AWGGYDMQRAPGHR
Download sequence
Identical sequences A0A2G5CFI4
Aquca_057_00009.1|PACid:22057404 Aquca_057_00009.2|PACid:22057403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]