SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_057_00037.2|PACid:22057413 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_057_00037.2|PACid:22057413
Domain Number - Region: 95-188
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0549
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_057_00037.2|PACid:22057413
Sequence length 244
Sequence
MAEETIINGKEDVGIEENKDLIKENEENREKIKLLMDEIEELKTDRLEMKKRLDERNEAD
KKTLEAISTRAAELEIEVSRLQHDLGSTMGENDDLVKELKDLKKGFEVLEKEKVELMGQI
AREKEENEKIKGELEKKEKEIVSWKMQKEEIESKIHLLEEALKNSEGRVGEMEVKSKELQ
SNLEELNEKKLVNGDAVVASESQCSRREFGFKGVKVQWPAALASTGTLAVAAAAAVYIHY
AKKR
Download sequence
Identical sequences A0A2G5CFH8
Aquca_057_00037.1|PACid:22057414 Aquca_057_00037.2|PACid:22057413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]