SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_057_00149.1|PACid:22057585 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_057_00149.1|PACid:22057585
Domain Number - Region: 133-178
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 0.0641
Family Anticodon-binding domain of PheRS 0.022
Further Details:      
 
Domain Number - Region: 49-94
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.076
Family DNA-binding N-terminal domain of transcription activators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_057_00149.1|PACid:22057585
Sequence length 224
Sequence
MLKNINIFKKKTSPKEELRSSKRDMAVATRGIEREIASLQLEEKKLVAEIKKTAKTGNEA
ATKILARQLVRLRQQITNLQGSRAQIRGVATHTQAMYASTAISSGMKGATKAMVAMNKEM
APAKQMKVMKEFQKQSSQMDMTLEMLSESIDETLDKDEAEEETEELTNQVLDEIGVDIAS
QLSSAPKGRLTAKKVGNASASAEAPPAPPDVEDLEKRLASLRRI
Download sequence
Identical sequences A0A2G5CG55
Aquca_057_00149.1|PACid:22057585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]