SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_057_00151.1|PACid:22057632 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_057_00151.1|PACid:22057632
Domain Number 1 Region: 31-131
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-16
Family Pleckstrin-homology domain (PH domain) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_057_00151.1|PACid:22057632
Sequence length 496
Sequence
MATNGSSSPRAEDTENSLEKIKRQLSSSSGRNLLQGPLLKRSETLRKWNERWMILDPTTG
KMEYKLRRTEAVVKGTIIFDANSNITISPVNFHGLPKYDGCCFYIGTPQKKEYYLCAETP
GAARAWVSTLHATQLVLRAHKEAVNSLSGNGSAKLGTVAAVVAAANSMALESTKEIEAAM
KISMRTALGMVTNRINEGPMDDLSIMKETLRVKDEELQQLARDLRARDSTIKEIAEKLTD
TAEAAQAAASAAHAMDEQRRFACSEIDRLTNESKKQLESSMLKLRVSEEKVMVVSKERDE
FLKQRDSALREAQLWRSELGKARERVVILEGAVVRAEERAKVAEADAEAKVKEAMGKELA
AVKDKEELLVYVNVLQAKLKRQQSDTKQVLEEKTESCSDALTKHVDLSDENVDKACLSDS
RSIPISRDGEVQVAVDQVDLRSIGDGEWNDIRANDSRIADVREIVPETVNNSLDIPVISV
PNNDHRDHDGNSFHQP
Download sequence
Identical sequences A0A2G5CFZ9
Aquca_057_00151.1|PACid:22057632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]