SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_057_00158.2|PACid:22057480 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_057_00158.2|PACid:22057480
Domain Number - Region: 59-124
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0101
Family Myosin rod fragments 0.0078
Further Details:      
 
Domain Number - Region: 256-318
Classification Level Classification E-value
Superfamily PAH2 domain 0.0575
Family PAH2 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_057_00158.2|PACid:22057480
Sequence length 321
Sequence
MTNNSTDFHLPDELLSVIPTDPYDQLDLARKITSMAIASRVSKLESETNRLRQKITEKDH
FIFQLEDKITKLEHSFQQSDSHLKLVLEENVKIAKERDSLAITAKRLTRDLSKLETFKRQ
LMQSLNDDNTSPAESVDIGTIDQPVSKAYSVKYDKETGNPTEDVSRHVGQKFSITTYISP
RLTPAETPNVISKGASPRGYSTAGSPNMTSGPTSPTKSPYEGRIAYSPWYSSSQQSSAAT
SPRRGRSISASAPRVDGKEFFRQARSRLSYEQFSAFLADIKEFNAQKQSREETLRKAEEI
FGTENRDLYLSFQGLLNRNSQ
Download sequence
Identical sequences A0A2G5CG50
Aquca_057_00158.2|PACid:22057480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]