SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_058_00024.3|PACid:22051311 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_058_00024.3|PACid:22051311
Domain Number - Region: 38-87
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_058_00024.3|PACid:22051311
Sequence length 136
Sequence
MGKNQAYKAMQKARSGSSSAAPDDLEDGMIDGTFHSPEWHAARLASLKTSHTITWEEFKK
KQKEDELRKGELEADKDKMMREYRAQLDAERETKLANGRNHSSTKSNHKKGKDIIIIDYR
DDQSTYLNDDHFKHEN
Download sequence
Identical sequences A0A2G5CEA8
Aquca_058_00024.3|PACid:22051311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]