SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_058_00034.1|PACid:22050989 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_058_00034.1|PACid:22050989
Domain Number - Region: 44-89
Classification Level Classification E-value
Superfamily Tim10-like 0.0497
Family Tim10/DDP 0.013
Further Details:      
 
Domain Number - Region: 12-39,79-147
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0536
Family Apolipoprotein A-I 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_058_00034.1|PACid:22050989
Sequence length 150
Sequence
MDHIAAAQERLVTERLRKKLNDVNVAAQTHLSPITDHVNFTLQQAYFKCAYDCFDRRRKQ
EEINNCVENCSIPVMNANSLVENEMAKFQERMNRSMMVCQDKFETATKFQQQKGGAMNDL
ESCVDLAIEDSIQMLPHVVNQLKATLSINE
Download sequence
Identical sequences A0A2G5CEG3
Aquca_058_00034.1|PACid:22050989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]