SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_058_00037.4|PACid:22051084 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_058_00037.4|PACid:22051084
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000702
Family PLC-like (P variant) 0.034
Further Details:      
 
Weak hits

Sequence:  Aquca_058_00037.4|PACid:22051084
Domain Number - Region: 137-192
Classification Level Classification E-value
Superfamily PH domain-like 0.0225
Family VPS36 N-terminal domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_058_00037.4|PACid:22051084
Sequence length 470
Sequence
MVPGSRNPMWGEEFNFFVDELPVQINITIYDWDIIWKSTVLGSVTVPVEGEGQTGALWHT
LDSSSGQVCLHIKTSKLPVNSSRVLNAHAGANARRKIQGPTVVHQKPGPLQTIFNLPADE
VVEHSYSCALERSFLYHGRLYVSSWHICFHSNVFSKQMKVIIPFDDVDEVKRSQHAFINP
AITIILRMGAGGHGVPPLGSPDGRVRYKFASFWNRNHAFRALQRTAKNFRDMLEAEKKEN
AQSALRAHSSSRVVSRGEAKIPVDNVPKAVKYQAFIKDEVLVDVYHDVFPCTPEQFFNVF
LSDNSKFTNEYRLERKDTDLKLGKWHAADEYEGQVRELTFRALCNSPMCPPDSSMTEWQH
VVLSADKKRMVFETVQQAHDVPFGSYFEIHCRWSLDADSESSSILDVKVGAHIKKWCVMQ
SKIRSGAINECKKEVGQMLEIARSYLMKSRTSDGCLNVAPDNPTVIHENA
Download sequence
Identical sequences A0A2G5CEE4
Aquca_058_00037.4|PACid:22051084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]