SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_058_00135.1|PACid:22051245 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_058_00135.1|PACid:22051245
Domain Number 1 Region: 49-154
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000011
Family 2Fe-2S ferredoxin-related 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_058_00135.1|PACid:22051245
Sequence length 162
Sequence
MAFASLQRISSRIPSIYQYSRSIITRSTATSTLPSSSSTTSAKVSDRIVKLFAIDFEGQK
REIIGLSGHTLLKALANNGLIDPESHRLEDIDACSAECEVNIAQEWLEKLPPATYDEQYV
LKRNARNRILNKHSRLGCQVVLNHELEGMVVAVPEPKPWDYC
Download sequence
Identical sequences A0A2G5CEX3
Aquca_058_00135.1|PACid:22051245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]