SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_060_00037.1|PACid:22039104 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_060_00037.1|PACid:22039104
Domain Number 1 Region: 211-319
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-25
Family Canonical RBD 0.0023
Further Details:      
 
Domain Number 2 Region: 94-205
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.18e-23
Family Canonical RBD 0.0038
Further Details:      
 
Domain Number 3 Region: 631-664
Classification Level Classification E-value
Superfamily WW domain 0.000000000564
Family WW domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_060_00037.1|PACid:22039104
Sequence length 782
Sequence
MPSSRSYDNHHRNPNHHHHRGGSGGGGGGFSGGRSHQPFDSPPPNYPSGGGGGGGSGFRP
IGGGGGGFRPIGGGGGAFRPMGGSGGDYPIPPPHAGQKRGYPFSGRGNSPPDGTDGSSFA
KLFVGSVPKTATEEEIRPLFEEHGDVIEVALLKDKRTGQQQGCCFIKFATSEDADRAIGA
LHNKYTLPGGFGPIQVRYADGERERLGAVEHKLFVGSMNKQATEKEIEEIFSPYGRVEDV
YIMRDEVKQSRGCGFVKFSHRDMAAAAIAALNGIYVMRGCEQALTVRFADPKRPRGGESR
GGVPAFGGPGVGPRSQSFSGPRPPPYLGEPLGGHAPPNAWHPMSPQGVGPSPQANAHGFA
SNTVRGGVAPVPSTMGGPMGAHGGPMNGVHGGHPLPVSSFQQNSEPSLSQAPPVGQQVSP
MQKPLQSPQQMLPPFHLQNQHMPGSYSQKETPPVSIQQTGQLQKPSAASQSSFNQMMPSQ
PSFGLNGQVPVSQSQVQQIGSTGSAPHVPLNFQRQGLSAPASQQQSLQSLQQPPTQLAQV
LSQQTQALQASYQSSQQAFSQLQQQLHLIQQSSQNSGQHQALPVNKQQSPWTGTIPHTGA
STPAIAPTVVVPSTSSATAAPMPTIAPLTCNWTEHSSPEGYKYYYNSVTAESRWEKPEEL
ALFEQQQQQQQIPQQQIQQQQKPPVQHQPQSQTHTHPQNQSSQQVSQAQHIQLQTQIHNQ
QQQFQLQRALNSVDLGYPQPQPMAGLGIDPTRFQQGPQAAQEWMWKNKPAGSFNFIYLYM
YD
Download sequence
Identical sequences A0A2G5CEX1
Aquca_060_00037.1|PACid:22039104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]