SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_060_00037.4|PACid:22039107 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_060_00037.4|PACid:22039107
Domain Number 1 Region: 76-184
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-25
Family Canonical RBD 0.0023
Further Details:      
 
Domain Number 2 Region: 496-529
Classification Level Classification E-value
Superfamily WW domain 0.000000000445
Family WW domain 0.0011
Further Details:      
 
Domain Number 3 Region: 5-71
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000175
Family Canonical RBD 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_060_00037.4|PACid:22039107
Sequence length 647
Sequence
MSIVLMFLCKSMGNLMELVYKTSTSTGCCFIKFATSEDADRAIGALHNKYTLPGGFGPIQ
VRYADGERERLGAVEHKLFVGSMNKQATEKEIEEIFSPYGRVEDVYIMRDEVKQSRGCGF
VKFSHRDMAAAAIAALNGIYVMRGCEQALTVRFADPKRPRGGESRGGVPAFGGPGVGPRS
QSFSGPRPPPYLGEPLGGHAPPNAWHPMSPQGVGPSPQANAHGFASNTVRGGVAPVPSTM
GGPMGAHGGPMNGVHGGHPLPVSSFQQNSEPSLSQAPPVGQQVSPMQKPLQSPQQMLPPF
HLQNQHMPGSYSQKETPPVSIQQTGQLQKPSAASQSSFNQMMPSQPSFGLNGQVPVSQSQ
VQQIGSTGSAPHVPLNFQRQGLSAPASQQQSLQSLQQPPTQLAQVLSQQTQALQASYQSS
QQAFSQLQQQLHLIQQSSQNSGQHQALPVNKQQSPWTGTIPHTGASTPAIAPTVVVPSTS
SATAAPMPTIAPLTCNWTEHSSPEGYKYYYNSVTAESRWEKPEELALFEQQQQQQQIPQQ
QIQQQQKPPVQHQPQSQTHTHPQNQSSQQVSQAQHIQLQTQIHNQQQQFQLQRALNSVDL
GYPQPQPMAGLGIDPTRFQQGPQAAQEWMWKNKPAGSFNFIYLYMYD
Download sequence
Identical sequences A0A2G5CDM5
Aquca_060_00037.4|PACid:22039107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]