SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_061_00012.7|PACid:22060916 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_061_00012.7|PACid:22060916
Domain Number 1 Region: 4-236
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.02e-38
Family Succinyl-CoA synthetase, beta-chain, N-terminal domain 0.0032
Further Details:      
 
Domain Number 2 Region: 258-397
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 1.07e-19
Family Succinyl-CoA synthetase domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_061_00012.7|PACid:22060916
Sequence length 421
Sequence
MARKKIREYDSKRLLKENFKRISGGSELPIKSAQVTESTDFNEVANKESWLSSGKLVVKP
DMLFGKRGKSGLVALNLDLAEVATFVKERLGKEVEMGGCKGPITTFIVEPFIPHTEEFYL
NIVSERIGCSLSFSECGGIDIEENWDKVKTVFIPTGSSLTSEICAPLFATLPLEINDTIK
EFVKVVYAIFLDLDFTFLEMNPFTLVDGKPYPLDMRGELDDTAAFKNFKKWSGVEFPLPF
GRVMSPTESFIHGLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELG
NYAEYSGAPNEEEVLQYARVVLDCATADPDGRKRALVIGGGIANFTDVAATFSGIIRALR
EKLKAARMHIYVRRGGPNYQRGLAKMRDLGEEIGIPLEVYGPEATMTGICKQAIECITAA
A
Download sequence
Identical sequences A0A2G5CEF1
Aquca_061_00012.7|PACid:22060916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]