SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_061_00064.1|PACid:22060840 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_061_00064.1|PACid:22060840
Domain Number 1 Region: 54-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000145
Family B3 DNA binding domain 0.0061
Further Details:      
 
Weak hits

Sequence:  Aquca_061_00064.1|PACid:22060840
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily RL5-like 0.00073
Family Ribosomal protein L5 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_061_00064.1|PACid:22060840
Sequence length 98
Sequence
MREIKVQKLVLDIYVGESRDRLARAAMVLVLLFNNHHSTVFSLYKHFSSDKMELAVGKRF
GQTKKYFGDKKILRSGWIHFAKEHKLDNGDVLFFELTA
Download sequence
Identical sequences A0A2G5CDD2
Aquca_061_00064.1|PACid:22060840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]