SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_062_00005.3|PACid:22033309 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_062_00005.3|PACid:22033309
Domain Number 1 Region: 345-469
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000549
Family WD40-repeat 0.034
Further Details:      
 
Domain Number 2 Region: 133-193
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000816
Family RING finger domain, C3HC4 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_062_00005.3|PACid:22033309
Sequence length 563
Sequence
MPPRTNIRGRGPHGGPHVVFHPRDIEDYFDIEEEAEILEYDDEQVEDEEEDDDDDDDDED
DESEEEEEEEDYLPIIRTNGRVSPNTRLNPARRIVFEDDSEPQPIQQQGQEDSKIESEGI
IIRSTGESSGSGNDNEGVCCPICMESWSSEGGHQVCCLPCGHVYGFSCIEKWIRQCKRNC
AKCPQCSRKCGIKDIIKLYISRIAVVDGEQQKKVLSLHAENEFLKMKIASLQERICQEEE
EKMLKDEASCLENMCFGEMRGQTSEFIAKSNDSHGQTQFGHTSTYGGQGSLCCSLKLEEE
FVVDGARVFDMDTSNRALILARRLPGMGGTHVLTKMSMMYPYESETIQLPISTKAVKDLH
VSPCGGKLALFASLGKKLSILSLESNNIVLTYDLPGPAWSCSWDVNGPQHLYAGLQDGTI
LMFDMRQTARPIESINGLSRHPIHTLHSLVQKSTTPCDAKTLLSASSIGPCVWNTGSARE
RPFLLAEMENQGVCISLAHCLSTDDIVASFRPKVQTSNDIINTQPSLSPSPTVLGRGILG
SHVLIKRKIATPCLHMGMNLPVD
Download sequence
Identical sequences A0A2G5CCU3
Aquca_062_00005.3|PACid:22033309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]