SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_062_00006.1|PACid:22033292 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_062_00006.1|PACid:22033292
Domain Number 1 Region: 160-334
Classification Level Classification E-value
Superfamily Bet v1-like 4.12e-37
Family STAR domain 0.0046
Further Details:      
 
Domain Number 2 Region: 6-115
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000105
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_062_00006.1|PACid:22033292
Sequence length 732
Sequence
MGVSQKDWKMEGWLYLIRSNRIGLQYSRKRYFILQDHCLKHFKSIPLSNKQDPARSAIID
SCIRVTDNGRESIHRKVLFIFTLYNTSNHNDQLKLGASSPEEAARWIRSFQEAASKEYPN
PGENMIGCTKRKWHRLNRTKERTRTSSIDWTFSSSMHPDLVTSDVIAPSPWTIFGCQNGL
RLFKEAKDRDFHGTNWDDHPAIMAVGVVDGTSEAIFRALMSLGPSRSEWDFCLFRGSVVE
HLDGHTDIVHKKLNRDWLPWGMSRRDLLLRRYWRREDDGTYVILYHSVFHKRCRPQNGYV
RACLKSGGYVISPVNKGKQSVVKHMLAIDWKFWKSYLRSSSARSMTIRMLGRVAALREYF
KARQGNHMLYDCSSGELTRDIRLPQSEIMEIQVDSADQAENGNSGEDNAVERLEKSSSIP
ASLGELNDAVDEFYDVPEPLDCNQSEYSQSSPEMHLQDQRQPRISTAANLVKRLHDLAVQ
KKGYMDLQELAREDSIPCCYGATLPKDPSHNMACSWTTADPSTFLIRGDQYLNDHQKVKA
KSTLMQMVGADWLRSDKREDDLGGRPESLVQKYAAQGRPEFFFIINIQVPGPTTYNLALY
YMMDTPVEDNPLLDSFVNGDDGFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINY
FRGNNYLELGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTEEELPEVLLGTCRLN
HLDASKSVLVKQ
Download sequence
Identical sequences A0A2G5CCV7
Aquca_062_00006.1|PACid:22033292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]