SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_062_00006.4|PACid:22033295 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_062_00006.4|PACid:22033295
Domain Number 1 Region: 135-303
Classification Level Classification E-value
Superfamily Bet v1-like 1.35e-35
Family STAR domain 0.0046
Further Details:      
 
Domain Number 2 Region: 7-115
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000603
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_062_00006.4|PACid:22033295
Sequence length 701
Sequence
MGVSQKDWKMEGWLYLIRSNRIGLQYSRKRYFILQDHCLKHFKSIPLSNKQVLFIFTLYN
TSNHNDQLKLGASSPEEAARWIRSFQEAASKEYPNPGENMIGCTKRKWHRLNRTKERTRT
SSIDWTFSSSMHPDLVTSDVIAPSPWTIFGCQNEAKDRDFHGTNWDDHPAIMAVGVVDGT
SEAIFRALMSLGPSRSEWDFCLFRGSVVEHLDGHTDIVHKKLNRDWLPWGMSRRDLLLRR
YWRREDDGTYVILYHSVFHKRCRPQNGYVRACLKSGGYVISPVNKGKQSVVKHMLAIDWK
FWKSYLRSSSARSMTIRMLGRVAALREYFKARQGNHMLYDCSSGELTRDIRLPQSEIMEI
QVDSADQAENGNSGEDNAVERLEKSSSIPASLGELNDAVDEFYDVPEPLDCNQSEYSQSS
PEMHLQDQRQPRISTAANLVKRLHDLAVQKKGYMDLQELAREDSIPCCYGATLPKDPSHN
MACSWTTADPSTFLIRGDQYLNDHQKVKAKSTLMQMVGADWLRSDKREDDLGGRPESLVQ
KYAAQGRPEFFFIINIQVPGPTTYNLALYYMMDTPVEDNPLLDSFVNGDDGFRNSRFKLI
PYISKGSWIVKQSVGKKACLVGQALEINYFRGNNYLELGIDIGSSTVARGVVSLVLGYLN
NLVIEMAFLIQANTEEELPEVLLGTCRLNHLDASKSVLVKQ
Download sequence
Identical sequences A0A2G5CCU4
Aquca_062_00006.4|PACid:22033295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]