SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_065_00013.1|PACid:22025962 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_065_00013.1|PACid:22025962
Domain Number 1 Region: 2670-2797
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000115
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Weak hits

Sequence:  Aquca_065_00013.1|PACid:22025962
Domain Number - Region: 885-984
Classification Level Classification E-value
Superfamily PH domain-like 0.00037
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_065_00013.1|PACid:22025962
Sequence length 4310
Sequence
MKGTPNISSTLGVAGKSGSGGKDTLLVLAVGRGSQEGNLFTILITDWVLHLLRKYLGEYV
YGLSSEALRISVWKGDVVLKDLKLKAEALNSLRLPVIVKAGFVGTITLKVPWKSLGKEPV
IVLIDRVFVLANPAPDGRTLKEEDRAKLFDAKLQQIEEAETATLEAKARSKLGNPASGSS
WLGSLIATIIGNLKISISNVHIRYEDSISNPGHPFSSGVTLAKLAAVTTDEQGNETFDAS
GALDKLRKSLRLERLALYHDSDSPSWKIDKNWEDLSPQEWVEIFEDGINEPSSDCGMRSS
WAMNRQYLVSPINGVLKYHRLGNQERKEQDIPFENASLALTDVSLSITEAQYHDFLKLLE
VLSRYKTHVDVSHLRPMVPVSDNPLQWWRYAVQAGLQQKKMCYRFSWDKIRYLCQLRRRY
IQLYVISLKQLSKGDNTEIREIERDLDSKVILLWRLLAHAKVESVKSMEQRNQMKRSWFS
FSWRASSDDVSDENDEGSQLEEDRLTKEEWQAINKLLSYQPDEDLTFQSGKSAHNMIQFL
VNVSVGQAAARIISSNQIEILCGRFEQLHITTKLYHRSTHCDVSLKFYGLSAPEGSLAQS
VSSERKANALAASFVHSPIGENVDWRLSATIAPCHVTVLMESYYRFIEFVKRSNAVSPTV
ALETATALQMKIEKVTRRAQEQLQMVLEEQSRFALDIDFDAPKVRVPLQMSSSSACDDHF
LLDFGHFTLHTKEAQSDEQRQSLYMRFYISGRDISACFINCGSGNDDCTMVNSKFDDQPS
ILSISEDADHYYSLIDKCGMVVIVDQIKVPHPSYPSTRISVQVPNLGIHLSPARYCRLME
LLNIVYGTVENNDQTASENLQTGLVLWSPADLATEARILVWRGIGNSVAEWQPCYIVLSG
LYLYVLESEASQTYQRCSSMIGRQIYEVPPTSVGGSPFSVAVGSRSMNVQKVLESSSTLI
IDFRDEEEKANWLKGLVQATYRASAPPAVDVLGGSSDDISEFAEPKATTYGAADLVINGA
LLVTKLLIYGKSGDPKCEKSEETLILEVLADGGKVHLVRFGGDLTVKMKLHSLKIKDELQ
GRFSKSPQYLACSVLKDETIVGSPDTMESNEKAVDRIFVEEEDIFKDALPEFMSFSDLIC
NSQNHDTPNSTTTFPSDGSEFGVCIDSAEALMHDKDLTKGVGNTAEIFYEVQDNDASDFV
SVTFTTRNPGSPFYDGIDTQMSIRMSKLEFYCNRPTLVALIGFGLDLSSVSSVPEDNMSE
VESSQNKERAEESGRAFVKGLLGFGKGRVVFRLNMDVDSVCIFLNKEDGSQLAMLVQESF
LLDLKVHPSSLSIDGTLGNFRLCDMSLGMDHCWGWLCDIRNQGSESLIKFTFNSYCAEDD
DYEGYDYSLHGRLSGVRIVFLYRFVQEVTIYFMELATPTTEEAIKLVDKVGGLEWLIEKY
EIDGALALKLDLSLDTPIIIVPRNSMSNDFLQLDLGHLQVINEFSWHGLPEKDPSAVHLD
ILHAEILGVNMAVGIDGVVGKPMIREGQGLHICVRRSLRDVFRKVPTFSIEVKVGVLHGV
MSDKEYSVILDCAYMNINEEPRLPPSFRGNTSAPKDTIRMLADKVNLNSQIFLSRTVTIV
AVEVDYALLELCNGIHEESPLAHLALEGLWVSYRMTSLSETDLYLTIPIFSIFDIRPDTR
PEMRLMLGSSSDASKQTYLGKYNDDTAPKNSEVTPPMDLPNSTMLLMDYRFRASSQSFVV
RVQQPRILVVPDFLLAVGEFFVPALGAITGREEALDPKNDPLTKTNSIVLTSNFYEQTDD
VVHLSPDRQLIVDALGVDEYTYDGCGGTICLKETTDTKDTLLSRSQPVIVIGRGKKLRFM
NVKIENGALLRKCTYLSVGSSYSVLAEDGVDILFLENMSTDNVAENLDYVLKSSETTTFQ
TDNDLNQIQSMTFEAQVVSPEFTFFDSTKLSLDDSLHGEKLLRAKLDLSFMYASKENDTW
IRTLVKDLTVEAGSGIVILDPMDISGGYTSLKDKTNISLMSTDICIRLPLSVISLVLNLQ
NQVVAALQLGNACPLASCTNFNRIWVSEKGNGPGYNLTFWRPQAPSNYVILGDCVTSRPI
PPSQAVMAVSNTYGRVRKPLGFKLVGLFSRIQALEGNGGQSDFDGDCSLWIPVPPPGYSA
LGCVAHIGNQPPPSHIAYCIRSDLVTATTYTECMLSIPSNPTFLSGFSIWRLDNVVGSFY
AHPEAEWPSRNSGYDLSHVLLWSANRHQSFSQNSTSEFTHEYDNESHQTSNNNSGSSGWD
ILRSISRASNCYVSTPHFERVWWDRGSDVRRPVSIWRPISRPGYAVLGDCITDGLEPPAL
GIIFRCDIPEVSAKPVQFAKVAHIERKGADDAFFWYPIAPPGYVSLGCIVSRTEDAPSLD
SFCCPRMDLVNPADILEVPISRSSTSKGSHCWSIWKVENQACTFLARSDLKKPTSRLAYS
IGDSVKPKTRENLSAEMKLRFFSLTVLDSLCGTMTPLFDTTITNVNLATHGRLESMNAVL
ISSIAASTFNPQLEAWEPLVEPFDGIFKFETYDTSSWLTSSFGKRVRIAATSPVNLNISA
ANLDTFAETIISWRRHAELEQKSTNINEETSTDLKHGDGSMFSALDEDDFQTVVIENKLG
CDFYLKKVEENSESIELLQHEHSASAWMPPPRFSDRLNVAAESRESRCYVAVKIYESKGL
PVVDDGNGHNFFCALRLVVDSHATDHHKLFPQSARTKCVKPSISNNNESEEGTARWNELF
IFEVPRKGQAKLEVEVTNLAAKAGKGEVVGSFSISTGQGVVTLKKVASARVLHALDAQNI
VSYPLKKRGQLDTDRSLHDFGCLQVSTSYFERKTIAKFQMETKSGNGNDSDVGFCIGFGR
EGPWESFRSLLPLSVVPKKLKENFVAMEILTKNGKKHAIFRGLATVVNDSDVKVDLCVCP
VSLLHSQSLLTSETSQRSVGVEEVFENQRYQPISGWGNKWPGFRGNDTGRWSTRDFSYSS
KDFFEPPLPPGWRWTSTWSIDKSQFVDSDGWAYGSDYQSLKWPPTSSKSCSKSPVDVVRR
RRWIRAKQQSISDNSTNNYISALSPGSSSVLPWKSMRRESDLCLQVRPYVEIPDPPYPWG
CTVSMGSGYASRSDQSGSSQGSLSRQTTMQSGNVLSNSQFRLNQLEKKDILFHCNSRTDS
KQVFWFSIGTDASVLHTELNAPVYDWKISINSPLKLENRLPCPAEFTIWERAKDGSSVER
KHSIITSRKSVHIYSADIRKPIYLTLFVQGGWVLEKDPILILDLYSLGHVSSFWMVHRQS
KRRLRVSIERDMGGTDAAPKTIRFFVPYWISNDSSMRLTYRMVEVEPSENAEADSMSLTR
AVKSAKVASKNPTNSSHMRNPGAKRNIQVLEEIEDSSLSPVMLSPQDYVGRGNVLSFPSR
NDTYLSPRIGISVALRNSEYYSPGISLLELENKERIDVKAFASDGSYYKLSAVLNTTSDR
TKVVHFQPQCVFINRVGRSISVQQCNTQVEEWFHPTDYPKPFQWKSTGKSELLQLRLDGY
QWSTPFSIGNEGVMCVSMKSDSNCGQMQLRVEVRSGTKRSSYEVIFRLASFSSPYRVENR
SMFLPIRFRQVDGSSDSWQFLLPNAAALFLWEDLGRQRLLEILVDGTDPLKLVKYNIDEV
SDHHPISVSGEPCSAVRVTIIKEEKTNVVIVSDWMPENKLSVRNPKNTPKLSRMYSHNQQ
SISTPGCEFHVTVELAELGLSIIDHTPEEILYLSVQNLLLSRTTGLGSGISRFKLRMHSI
QVDNQLPLSPMPVLFRPQRVGEKLDYILKLSQSNGSLDLWIYPYIGFHVGPENSAFIINI
HEPIIWRLHEMIQKVNLSRLSNPQSTAVAVDPIIQIGVLNISEIRLKVSMAMSPTQRPRG
VLGFWSSLMTALGNTENMPVRINQRFHEDICMRQSALISTAVSNIQKDLLSQPLQLLSGV
DILGNASSALGHMSKGVAALSMDKKFIQSRQRQESKAVEDIGDVIREGGGALAKGFFRGV
TGILTKPLEGAKSSGVEGFVQGVGKGIIGAAAQPVSGVLDLLSKTTEGANAVRMKILSAI
TSEEQLLRRRLPRVISGDNLVCPYNEYKAQGQVILQLAESGAFFGQVDLFKVRGKFALSD
SYEDHFLLPKGKIIIITHRRVILLQLPSNIIAQRKFSPARDPCSILWDVLWDDFVTMELR
HGKKDPPNTPPSQLVLYLQMRSTDSKEHTRTIKCNRNSQQAFEIYCSVDQAMNIYGPNHS
KAMQKKVLKPYAPNMDGDAEVIPKEGFCSWSPQQVPVSVPLRSTFGSNTT
Download sequence
Identical sequences A0A2G5CC72
Aquca_065_00013.1|PACid:22025962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]