SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_066_00041.1|PACid:22032767 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_066_00041.1|PACid:22032767
Domain Number 1 Region: 1945-2138,2171-2273
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.45e-27
Family WD40-repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 20-87,247-311,447-577
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000326
Family WD40-repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_066_00041.1|PACid:22032767
Sequence length 2276
Sequence
MVSATWFSGGPVATNARSGCVLVSQMDEKAGFLTSQLSHPQPVSMIQWRPCVRLHSQRNV
LLTCCLDGTVRLWSEIDNGRAKHAKQAFHVLAVIEINQSLNGALGMDTFVTWTAEIRDMT
DEGGGVNCSESEGSDLNIPGRCEWLISYGPQMFLTFWAIHCLDDISPLRLPRVTLWKTLD
LAEAEGHYVDTAGNLKSNDHSLFIKAVISRRRVHGPPTKCFLIQLLSDNSMGWLQLNSIE
SSNPQGESLSLDGHTGNILQVAVHPYGFEVELAVSLDSNGLLLFWSLSTISNSILGIPPL
ALPTWKLVGKVATKHLSCVEYSCLKWAPSILMDYSVLLLGHSKGIDCFIIEIAETEALSW
EVTLHSAELSGSSCDCNNDVREVAEITTRRYESYFAGKRYCLVAEPCSSTFPDSHCPDQV
TSVAVVSPGSLMPSVQQKWSSYVGVYNNSSPYHMATGYSDGSVRLWRSTCSKWSTSHSEL
AHISWELVGMFHTHHGPVTVVSLSCGGKVATISMESCTKNISTLCVWQSVRIMNAGSFLL
EDEISLSGCSVAMNWFSIGSGQLLLGVCMQNELRIYAQRSFGSQSHGKSGKLLETHIWYC
IAIGTTCLAARNFLWGPGATPIVLHDRYFCLFSKWSYHTDKKHQTMIYVQCTKDNSPTFM
GGSDKAFVCAVFTDCNMYNINKLSLDGISEKSKALLPPKLNVSIDYPVCSLFSSMVQQQC
NSGSKIGLRSILEVNGKLRGSLPIYHPEALLQNLYSGHWRRAFVAVRHLVEYLTSDSTSV
ACEKAYDSIKPKNIIPQILLSKYFEEPFSTGLSNKGFVWGGDAAVVSSDAKFQINSIEFF
EHGADGNGFSNALNSGSVKSEISRFIETIQKFNDIAAITSMERMQILAVIELLDEICDSS
CASAYESLDEPGRRFWVAIRFQQLHFLRRFGKSTKNELVVDSGMIAWAFQSDCQDSLLTC
FLSNEPSWDEMRNLGVGFWFTNATLLRTRMEKLARSQYLKKKDPRDCALLYVALNRLQVL
AGLFKISKDEKDKPLVGFLSRNFQDEKNKGAALKNAYVLMGRHQLELAVAFFLLGGDSSS
AVSVCAKNLGDEQLALVICRLTEGNGGSLERHLISKHLLPAAVERSDWWRASLFEWTSGN
YAQSFERLLGFKMDPLVNKSVLPSNQASFLDPMVGQYCLVLATKSSMKNHIGESAAVILA
RWAVLMTLIALNRRGLPIEALQCFSSSLSTAEGKDEGGFTKLRHHGIPHEIFEEPNDALN
WLSGDVAMQMEANDKMNLALHYISNLLTEHPSWTDTISFSLKSLVCNEEYRHCQYNLSLE
SFQHRLIAGLATFEQRCSLKPVDILNMILFYSSNNGTLFLGYHILHDYITREFPPDENHK
FDSIFWYHPIPKLFLKASKEVSWLFARYLMCNSVIYSLPNFVFPLHEVLSTNRSHQLHVW
GVYTRRSLQILDSFKVTLKMYSPSFLSEDHMRKTFTAVDLLEYYIISTLALLQKNLRGLI
LTIHPILSTYSHGHTPSNVDVENLKKQLFQNVELMICNSHSDDIEHLSGASSKQWEHGQN
GELLAQIPDDEKWQILGACLWRHLLNFSRDLLKFPPNSPTSNISSSPVSRVSSLISANGN
FEYDKNFPLEAFVQVPKLFAKVLENTLACIASCHTKQFATVMSLKLEKENHVPTLLWLQK
FDHFESTALYNCVKPDVNYMEMISSETQASLFRILWEMSVDPMVLRTALSQEKMSWLLSN
VRKLSRGWNWSAYKNGHTLNDDQEGNSISCANGEGTSPGEKSSQDSSGLLRSKQKDSPLS
TEVTYFQRPKDIFMRSGELLEAMCINSINQQQAAVASNRKGILFFERKDDELSKYHSEFI
WSEADWPQNGWASSESTPVPTFVSPGIGLGSKNGTHLGLGGGTMGLDSFTRFETDLTDRR
AYQASDYGGAGSSGLGWGTQEDFEFVDLPATVDNISTRAFSSHPSRPFFLAGSSNTHIYL
WEFGKEKATATYGVLPAANVPPPYALASIAALQFEDCGHRFVTAALDGTICTWQLEVGGR
SNILPTESSLCFNRHAMDVTYVAASGSVIAAAGYSSDDVNVVIWDTLAPNTTSQASLICH
EGGARSVSVFDNNLGSGSISPLIVTGGKDGDVGLHDFRFIATGKTKRHRHSNSATLETQL
GVSRKFGEQHSKGMLWYIPKAHLGSIVKIATVPNSSFFLTGSKDGDVKLWDAKKAELVFH
WPKLHERHTFLQPSTRGFGGIVRAGVTDIQVLPHGFLTCGGDGSVKMVEIKNYPYK
Download sequence
Identical sequences A0A2G5CC44
Aquca_066_00041.1|PACid:22032767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]