SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_066_00041.2|PACid:22032768 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_066_00041.2|PACid:22032768
Domain Number 1 Region: 1563-1756,1789-1891
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-27
Family WD40-repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 63-197
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000029
Family WD40-repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_066_00041.2|PACid:22032768
Sequence length 1894
Sequence
MSSRLSHGKLPCTLLSYLEAAVTAIMMLERLRRLLHGDMKVILLVKGSLMPSVQQKWSSY
VGVYNNSSPYHMATGYSDGSVRLWRSTCSKWSTSHSELAHISWELVGMFHTHHGPVTVVS
LSCGGKVATISMESCTKNISTLCVWQSVRIMNAGSFLLEDEISLSGCSVAMNWFSIGSGQ
LLLGVCMQNELRIYAQRSFGSQSHGKSGKLLETHIWYCIAIGTTCLAARNFLWGPGATPI
VLHDRYFCLFSKWSYHTDKKHQTMIYVQCTKDNSPTFMGGSDKAFVCAVFTDCNMYNINK
LSLDGISEKSKALLPPKLNVSIDYPVCSLFSSMVQQQCNSGSKIGLRSILEVNGKLRGSL
PIYHPEALLQNLYSGHWRRAFVAVRHLVEYLTSDSTSVACEKAYDSIKPKNIIPQILLSK
YFEEPFSTGLSNKGFVWGGDAAVVSSDAKFQINSIEFFEHGADGNGFSNALNSGSVKSEI
SRFIETIQKFNDIAAITSMERMQILAVIELLDEICDSSCASAYESLDEPGRRFWVAIRFQ
QLHFLRRFGKSTKNELVVDSGMIAWAFQSDCQDSLLTCFLSNEPSWDEMRNLGVGFWFTN
ATLLRTRMEKLARSQYLKKKDPRDCALLYVALNRLQVLAGLFKISKDEKDKPLVGFLSRN
FQDEKNKGAALKNAYVLMGRHQLELAVAFFLLGGDSSSAVSVCAKNLGDEQLALVICRLT
EGNGGSLERHLISKHLLPAAVERSDWWRASLFEWTSGNYAQSFERLLGFKMDPLVNKSVL
PSNQASFLDPMVGQYCLVLATKSSMKNHIGESAAVILARWAVLMTLIALNRRGLPIEALQ
CFSSSLSTAEGKDEGGFTKLRHHGIPHEIFEEPNDALNWLSGDVAMQMEANDKMNLALHY
ISNLLTEHPSWTDTISFSLKSLVCNEEYRHCQYNLSLESFQHRLIAGLATFEQRCSLKPV
DILNMILFYSSNNGTLFLGYHILHDYITREFPPDENHKFDSIFWYHPIPKLFLKASKEVS
WLFARYLMCNSVIYSLPNFVFPLHEVLSTNRSHQLHVWGVYTRRSLQILDSFKVTLKMYS
PSFLSEDHMRKTFTAVDLLEYYIISTLALLQKNLRGLILTIHPILSTYSHGHTPSNVDVE
NLKKQLFQNVELMICNSHSDDIEHLSGASSKQWEHGQNGELLAQIPDDEKWQILGACLWR
HLLNFSRDLLKFPPNSPTSNISSSPVSRVSSLISANGNFEYDKNFPLEAFVQVPKLFAKV
LENTLACIASCHTKQFATVMSLKLEKENHVPTLLWLQKFDHFESTALYNCVKPDVNYMEM
ISSETQASLFRILWEMSVDPMVLRTALSQEKMSWLLSNVRKLSRGWNWSAYKNGHTLNDD
QEGNSISCANGEGTSPGEKSSQDSSGLLRSKQKDSPLSTEVTYFQRPKDIFMRSGELLEA
MCINSINQQQAAVASNRKGILFFERKDDELSKYHSEFIWSEADWPQNGWASSESTPVPTF
VSPGIGLGSKNGTHLGLGGGTMGLDSFTRFETDLTDRRAYQASDYGGAGSSGLGWGTQED
FEFVDLPATVDNISTRAFSSHPSRPFFLAGSSNTHIYLWEFGKEKATATYGVLPAANVPP
PYALASIAALQFEDCGHRFVTAALDGTICTWQLEVGGRSNILPTESSLCFNRHAMDVTYV
AASGSVIAAAGYSSDDVNVVIWDTLAPNTTSQASLICHEGGARSVSVFDNNLGSGSISPL
IVTGGKDGDVGLHDFRFIATGKTKRHRHSNSATLETQLGVSRKFGEQHSKGMLWYIPKAH
LGSIVKIATVPNSSFFLTGSKDGDVKLWDAKKAELVFHWPKLHERHTFLQPSTRGFGGIV
RAGVTDIQVLPHGFLTCGGDGSVKMVEIKNYPYK
Download sequence
Identical sequences A0A2G5CC19
Aquca_066_00041.2|PACid:22032768 Aquca_066_00041.3|PACid:22032769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]