SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_067_00053.1|PACid:22042807 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_067_00053.1|PACid:22042807
Domain Number 1 Region: 966-1114,1147-1201,1231-1288
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000133
Family Cell cycle arrest protein BUB3 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_067_00053.1|PACid:22042807
Sequence length 1298
Sequence
MKKFEEESSSDGLEIISIGSLYKGSCWYKKYWSSSRGKDRHPYPIGYHAVRTHNGITYEM
EIREGLNGPLFVITSTDGESCSGQTPDITWESFQKKSAPRAKLGQRKRFSCKIDGAEFFG
FRNALVQRLLRNIASNVDGRAEQNLPSPGLCNKAHRVELDTQSPESCNRLDLLPNVIKSQ
NIRKRSRKDKIATIGTASGPELRRLQAQDVSDNPEYSITDKYNQRHRTGERCFTILNEDC
EVGNSPKSFSAAVKNELLERGNNSSLVNEDSALDSWRTADPIKMDADLLPEHQFVGRGDS
RFISSVINPSKLEEHVRMIDTSVDAYTQGCESLKATKDAIRERMSEESKTVKNLDLCVPD
SLDVLQDKVSDSAPNWETARSLHGEDEVGMYTFNGSSQKCSDDSIGEELAKSMMTLLLPQ
ALPLLKKRSSRKRTKVHISENSIYNGDGCLSLDARKLSEEGDGVYDAANTSPVGMMVKES
SKNMERQAHCLNKTHLEGAKSIVPDSFEDEQFDSHTSYQRSFCPDSNEVDDKELGPTKNI
LSSESAFIVQNETEPTQSESTLNYVISDSSLADELPSKGFARSLDMVASTSEPDNVKEVH
THNSTKNMGKMSGGRSNDKPIQYSRIHRSTSKKDQNSSSHGNKDSVVIKKMSATREAIDI
NSILRQSSVHMSEKEVDIIETRDSKNSNISSIRKSGLPPSKRFRGPLSESIIYRNNTDSC
LPDADNLFATEFDKVGASVDNLYKKVSIGGEVRLDQKSKNCSMEFGTVRLNGMHSQVQAV
LDHSAKNKDHTDGKIHQDDVITDGTGSSILFQEIKKSFSFDDHLLAKENFGELNMQSQFK
SVTASGPNNGHLIFDHELHEEHLLADHQFSLNTEDNYTSKDFVELVGCYVQPAPILSVVL
SSQGDDVHIAVLCGILADRPRTIFVYKVSLKEPSRGCPSFLGYTPLMLPISKYAFCGEIA
FEKFPVQFTPDGQGLVISNSIKAPYCREQSIHCVCSVCTSACSEENAVKIIHVKLGYVSL
AAKLKTEDNVHSILVCEPSHLVAVEKNGRVIVWSMNSMWNEKVEEFILPSLTHTPPCTLE
LKKIPKHPSLVVGHNRFGDFGLWDISKRTILSTFYAPRNCIFQFLPVGLFGWKRPASAGI
YVEEQIKGIMSATKRCFSGTSVDGFLSFDDEDIAVWLLVSAVWDSEVRFDHKANGINTSA
NGSWRLALLVNNRVILGQPLDPRASVINALEGCGIIGSHDGLVYIWELSTGLKLADLHHF
NSGRVSCISSDSKSGVLAVAGDENQLLVYAIPQPMCNS
Download sequence
Identical sequences A0A2G5CBX6
Aquca_067_00053.1|PACid:22042807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]